Research any topic before you write.

Find related topics. | Discover entities. | See connections. | Build a topical map.

TOPS-20: Companies, TOPS-20 capabilities & TOPS-20 today

The TOPS-20 operating system by Digital Equipment Corporation (DEC) is a proprietary OS used on some of DEC's 36-bit mainframe computers. The Hardware Reference Manual was described as for "DECsystem-10/DECSYSTEM-20 Processor" (meaning the DEC PDP-10 and the DECSYSTEM-20).

Language: English [EN]
Use the mouse wheel or two fingers (on touchscreens) to zoom in and out of the map.
100%
More settings
100% 100% 100% 100% 100%

TOPS-20 topic overview

The analysis highlights Companies, TOPS-20 capabilities and TOPS-20 today as prominent areas in the source structure around TOPS-20.

Related topics
43
Source areas
4
Connected nodes
47
Extracted relationships
71
Related term clusters
17
Bridge connections
47

What this topic covers Research coverage

Source areas are shown by the number of related topics found in each part of the analysis. Use smaller areas too: they can reveal specialized angles and content gaps.

TOPS-20 capabilities · 27 topics
Overview · 11 topics
TOPS-20 today · 4 topics
TENEX · 1 topics

Smaller areas are not necessarily less important. They contain fewer connections in this analysis and can be useful for finding specialized angles or coverage gaps.

Key facts & relationships

High-confidence facts extracted from structured source data. Use them as anchors for further research.

Available in
English
Default user interface
Command-line interface
Developer
Digital Equipment Corporation
Initial release
1976; 50 years ago (1976)
Latest release
7.1 / June 1988; 38 years ago (1988-06)
License
Proprietary

Start with your topic. Discover where to go next.

Explore different angles and find fresh ideas to shape your next piece of content.

Explore all related topics Closing gaps

Browse the complete topic structure, not only the most central items. Less prominent entities and concepts can reveal missing angles, specialized context and useful research gaps. Each item opens a new analysis centered on that subject.

Overview

TENEX

TOPS-20 capabilities

TOPS-20 today

For the semantics nerds

You can skip this section if you’re here for content ideas and keyword inspiration.

Advanced semantic analysis

How TOPS-20 connects Entity context

The extracted context around TOPS-20 shows recurring relationship patterns in the source. For example, TOPS-20 → DEC, JSYS, Model, PA, PA1050, PAT, PDP, Sometimes PA1050, TOPS-10 Operating System's, Unimplemented User Operation, UUO's Another extracted example is TOPS-20 → After Digital, BBN, Bolt Beranek, DEC PDP-10, Digital, Digital's PDP-10, KI-10, KI-10s, Newman, PDP-10, TENEX. Use these groups to spot repeated connection types before inspecting the individual relationships.

TOPS-20

Top relations

related to PA1050 · 11
TOPS-20 → DEC, JSYS, Model, PA, PA1050, PAT, PDP, Sometimes PA1050, TOPS-10 Operating System's, Unimplemented User Operation, UUO's
related to TENEX · 11
TOPS-20 → After Digital, BBN, Bolt Beranek, DEC PDP-10, Digital, Digital's PDP-10, KI-10, KI-10s, Newman, PDP-10, TENEX
related to JSYS features · 9
TOPS-20 → Get Job File Number, GTJFN, Internally, JFN, JSYS, Jump, OPENF, Operands, SYStem
related to TOPS-20 today · 8
TOPS-20 → Currently TOPS-20, Distribution, Mark Crispin's TOPS-20 Panda, Paul Allen, SDF Public Access Unix, See, System, XKL TOAD-2
related to PCL (Programmable Command Language) · 7
TOPS-20 → DECLARE, EXEC, Filetype, Newly, PCL, Programmable Command Language, TOPS-20 EXEC
related to TOPS-20 capabilities · 7
TOPS-20 → Commands, EXEC, EXEJSYS, Jump, MAC, MACro-language, System
related to Command processor · 3
TOPS-20 → Command, Rather, TOPS-20-specific
related to Commands · 2
TOPS-20 → ACCESSADVISEAPPENDARCHIVEASSIGNATTACHBACKSPACEBLANKBREAKBUILDCANCELCLOSECOMPILECONNECTCONTINUECOPYCREATECREFCSAVEDAYTIMEDDTDEASSIGNDEBUGDEFINEDELETEDEPOSITDETACHDIRECTORYDISABLE…, TOPS-20 Command Processor
Available in · 1
TOPS-20 → English
Default user interface · 1
TOPS-20 → Command-line interface

Important terminology

Use these terms to understand the vocabulary surrounding the topic, not as a checklist for keyword stuffing.

Important terminology

tenex pdp-10 system dec tops-10 operating pa1050 calls run command processor digital commands available language named jsys pcl computers access

TOPS-20 relationships Subject–Predicate–Object triples

TTTA extracted 71 structured relationships around TOPS-20. Examples in this analysis include TOPS-20 → Available in → English and TOPS-20 → Default user interface → Command-line interface. The table shows each extracted connection, where it came from and its confidence.

SubjectPredicateObjectConfidenceSrc
TOPS-20Available inEnglish1.00infobox
TOPS-20Default user interfaceCommand-line interface1.00infobox
TOPS-20DeveloperDigital Equipment Corporation1.00infobox
TOPS-20Initial release1976; 50 years ago (1976)1.00infobox
TOPS-20Latest release7.1 / June 1988; 38 years ago (1988-06)1.00infobox
TOPS-20LicenseProprietary1.00infobox
TOPS-20Marketing targetMainframe computers1.00infobox
TOPS-20OS familyTENEX1.00infobox
TOPS-20Preceded byTENEX1.00infobox
TOPS-20Supported platformsPDP-101.00infobox
TOPS-20Working stateDiscontinued1.00infobox
TOPS-20Written inAssembly language1.00infobox
TOPS-20is aexcellent longer history.Panda TOPS-20 distribution.SDF Public Access TWENEX.SIMH Simulator capable of simulating the PDP-10 and running TOPS-20.Manuals for DEC 36-bit computers…0.90text

Related concept clusters Related term clusters

The concept neighborhoods around TOPS-20 bring nearby vocabulary together. In this analysis, examples include System, Operating and Command. Use the clusters to find adjacent concepts and terminology that may deserve separate research.

  • TOPS-20
    • System
    • Operating
    • Command
    • Pcl
    • Tenex
    • Emulation
    • Language
    • Running
    • Commands
    • Digital
    • Named
    • Processor
  • tops-20
    • System
    • Operating
    • Command
    • Pcl
    • Tenex
    • Emulation
    • Language
    • Running
    • Commands
    • Digital
    • Named
    • Processor
  • operating system
    • Digital
    • Tenex
    • System
    • Corporation
    • Equipment
    • Mainframe
    • Os
    • Proprietary
    • Access
    • Jsys
    • Computers
    • Tops-20
  • digital equipment corporation
    • Corporation
    • Equipment
    • Mainframe
    • Os
    • Proprietary
    • Computers
    • Operating
    • Digital
    • Tenex
    • System
    • Available
    • Language
  • mainframe computers
    • Os
    • Proprietary
    • Computers
    • Corporation
    • Equipment
    • Mainframe
    • Digital
    • Operating
    • Available
    • Dec
    • Language
    • Languages
  • sdf public access unix system
    • Information
    • Tenex
    • Access
    • Digital
    • Jsys
    • System
    • Tops-20
    • Corporation
    • Equipment
    • Mainframe
    • Os
    • Proprietary
  • tops-20 capabilities
    • System
    • Operating
    • Command
    • Pcl
    • Tenex
    • Emulation
    • Language
    • Running
    • Commands
    • Digital
    • Named
    • Processor
  • tops-20 today
    • System
    • Operating
    • Command
    • Pcl
    • Tenex
    • Emulation
    • Language
    • Running
    • Commands
    • Digital
    • Named
    • Processor

Connections between topic areas Semantic bridges

For TOPS-20, one of the stronger structural bridges in this analysis connects TOPS-20 with TOPS-20 capabilities. Bridges highlight paths between different parts of the map and can reveal research angles that are easy to miss in a flat list.

Min side: 3
TOPS-20 — TOPS-20 capabilities · splits 20 ⟂ 28
TOPS-20 — Overview · splits 36 ⟂ 12
TOPS-20 — TOPS-20 today · splits 43 ⟂ 5

Map overview Semantic statistics

TOPS-20

Nodes48
Edges47
Triples71
Avg. degree1.96
Density0.041667
Components1

Source & methodology

TTTA analyzes the structure around TOPS-20 to surface related topics, entities, relationships, concept neighborhoods and bridge connections. Use the map to explore areas such as Companies, TOPS-20 capabilities & TOPS-20 today, including less central topics that may reveal useful research gaps. Automatically extracted connections are research leads rather than rewritten encyclopedia content.

Source: Wikipedia — TOPS-20 · EN edition · Analysis: TopicsToTalkAbout

For writers, content strategists, SEOs, marketers and creators — from quick topic research to advanced semantic analysis.

Monitor your Domain Rating with FrogDR